HORDB

General Information

ID: hor005797
Uniprot ID: P30990
Protein name: Tail peptide
Gene name: NTS
Organism: Homo sapiens (Human)
Family: Neurotensin family
Source: Human
Expression: NA
Disease: Diseases associated with NTS include Dumping Syndrome and Duodenogastric Reflux.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0048018 receptor ligand activity; GO:0071855 neuropeptide receptor binding
GO BP: GO:0007165 signal transduction; GO:0007218 neuropeptide signaling pathway; GO:0010628 positive regulation of gene expression; GO:0010629 negative regulation of gene expression; GO:0051092 positive regulation of NF-kappaB transcription factor activity; GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region; GO:0030133 transport vesicle; GO:0031410 cytoplasmic vesicle; GO:0043231 intracellular membrane-bounded organelle; GO:0043679 axon terminus

Sequence Information

Sequence: DSYYY
Length: 5(166-170)
Propeptide: MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY
Signal peptide: MMAGMKIQLVCMLLLAFSSWSLC
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
Mechanism: NA
Cross BBB: NA
Target: NTSR1
Target Unid: P30989
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P30990-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005797_AF2.pdb

hor005797_ESM.pdb

Physical Information

Mass:	78123	Formula:	C34H39N5O12
Absent amino acids:	ACEFGHIKLMNPQRTVW	Common amino acids:	Y
pI:	3.75	Basic residues:	0
Polar residues:	4	Hydrophobic residues:	0
Hydrophobicity:	-164	Boman Index:	-1254
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	0
Instability Index:	9588	Extinction Coefficient cystines:	4470
Absorbance 280nm:	1117.5

Literature

PubMed ID: 9530155
Title: DNA methylation contributes to expression of the human neurotensin/neuromedin N gene.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 1436492
Title: Cloning of human neurotensin/neuromedin N genomic sequence
PubMed ID: 6208535
Title:
PubMed ID: 11294867
Title:
PubMed ID: 19122660
Title:
PubMed ID: 23140271
Title: